Contactar Proveedor? Proveed
Amy Cheng Ms. Amy Cheng
¿Qué puedo hacer por ti?
Chatear Ahora Contactar Proveedor
Taizhou Volsen Chemical Co., Ltd.
HomeLista de ProductosProductos PeptídicosTeriparatide Acetate 52232-67-4
Teriparatide Acetate 52232-67-4
  • Teriparatide Acetate 52232-67-4

Teriparatide Acetate 52232-67-4

    Precio unitario: 1~1 USD
    Tipo de Pago: T/T
    Incoterm: CIF
    Cantidad de pedido mínima: 1 Kilogram
    Plazo de entrega: 15 días

Información básica

Modelo: 52232-67-4

Información adicional


productividad: KGS


transporte: Air

Lugar de origen: CHINA

Capacidad de suministro: TRUE MANUFACTURER

Certificados : GMP Peptide


Nosotros, China teriparatida Acetato 52232-67-4 Proveedores y China, PTH (1-34) (humana) | Teriparatide Fabricantes, proporcionan fragmento de la hormona paratiroidea de China (1-34) los productos y los productos relacionados con China hormona paratiroidea 1-34 HUMANO

Thera. Goría gato: péptido Farmacéutica

Cas. No: 52232-67-4

Sinónimos: Hormona paratiroidea HUMANOS: Fragmento 1-34; Hormona paratiroidea (humanos, 1-34); La hormona paratiroidea (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); La teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF


Fórmula molecular: C172H278N52O47S2

Peso molecular: 3890.49792

Pureza: ≥98%

Embalaje: embalaje de exportación digna

Hoja de Seguridad: Disponible a pedido

Uso: La teriparatida es idéntica a una porción de hormona humana parathyrod (PTH) y el uso intermitente activa los osteoblastos más de osteoclates, lo que conduce a un aumento global en el hueso.

PRODUCTOS POR GRUPO : Productos Peptídicos

Contactar proveedor
  • Amy ChengMs. Amy Cheng
  • Su mensaje debe ser de entre 20 a 8,000 caracteres.