Detalles de la compañía
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Tipo de Negocio:Fabricante
  • Main Mark: Américas , Asia , Europa del este , Europa , norte de Europa , Otros Mercados , Europa occidental , En todo el mundo
  • Exportador:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Descripción:Acetato de Teriparatide,52232-67-4,CAS 52232-67-4
Taizhou Volsen Chemical Co., Ltd. Acetato de Teriparatide,52232-67-4,CAS 52232-67-4
Inicio > Lista de Productos > Productos Peptídicos > Teriparatide Acetate 52232-67-4

Teriparatide Acetate 52232-67-4

    Precio unitario: 1~1 USD
    Tipo de Pago: T/T
    Incoterm: CIF
    Cantidad de pedido mínima: 1 Kilogram
    Plazo de entrega: 15 días

Información básica

Modelo: 52232-67-4

Información adicional


productividad: KGS


transporte: Air

Lugar de origen: CHINA

Capacidad de suministro: TRUE MANUFACTURER

Certificados : GMP Peptide


Nosotros, China teriparatida Acetato 52232-67-4 Proveedores y China, PTH (1-34) (humana) | Teriparatide Fabricantes, proporcionan fragmento de la hormona paratiroidea de China (1-34) los productos y los productos relacionados con China hormona paratiroidea 1-34 HUMANO

Thera. Goría gato: péptido Farmacéutica

Cas. No: 52232-67-4

Sinónimos: Hormona paratiroidea HUMANOS: Fragmento 1-34; Hormona paratiroidea (humanos, 1-34); La hormona paratiroidea (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); La teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF


Fórmula molecular: C172H278N52O47S2

Peso molecular: 3890.49792

Pureza: ≥98%

Embalaje: embalaje de exportación digna

Hoja de Seguridad: Disponible a pedido

Uso: La teriparatida es idéntica a una porción de hormona humana parathyrod (PTH) y el uso intermitente activa los osteoblastos más de osteoclates, lo que conduce a un aumento global en el hueso.

PRODUCTOS POR GRUPO : Productos Peptídicos

Imagen de Producto
  • Teriparatide Acetate 52232-67-4
Contactar proveedor
  • *Asunto:
  • *Mensajes:
    Su mensaje debe ser de entre 20 a 8,000 caracteres.

Sitio Web Mobile índice. Mapa del sitio

Suscríbete a nuestro boletín:
¡Obtén actualizaciones, ofertas especiales, grandes premios y descuentos!

Copyright © 2019 Taizhou Volsen Chemical Co., Ltd. Todos los derechos reservados.
Contactar Proveedor?Proveed
Amy Cheng Ms. Amy Cheng
¿Qué puedo hacer por ti?
Chatear Ahora Contactar Proveedor