Detalles de la compañía
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Tipo de Negocio:Fabricante
  • Main Mark: Américas , Asia , Europa del este , Europa , norte de Europa , Otros Mercados , Europa occidental , En todo el mundo
  • Exportador:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Descripción:Fragmento de la hormona paratiroidea 52232-67-4,Fragmento de hormona paratiroidea CAS 52232-67-4,PTH 1-34 Humanos
Taizhou Volsen Chemical Co., Ltd. Fragmento de la hormona paratiroidea 52232-67-4,Fragmento de hormona paratiroidea CAS 52232-67-4,PTH 1-34 Humanos
Inicio > Lista de Productos > Productos Peptídicos > Fragmento de la hormona paratiroidea (1-34) (CAS 52232-67-4)

Fragmento de la hormona paratiroidea (1-34) (CAS 52232-67-4)

Compartir:  
    Precio unitario: USD 1 / Kilogram
    Tipo de Pago: T/T
    Incoterm: CIF
    Cantidad de pedido mínima: 1 Kilogram
    Plazo de entrega: 15 días

Información básica

Modelo: 52232-67-4

Información adicional

Paquete: SEGÚN SEA NECESARIO

productividad: KGS

Marca: VOLSENCHEM

transporte: Air

Lugar de origen: CHINA

Capacidad de suministro: TRUE MANUFACTURER

Certificados : GMP Peptide

DDescripción


Somos uno de la teriparatida Acetato

CAS 52232-67-4 proveedores en el mercado chino. Teriparatide es una forma recombinante de la hormona paratiroidea. Es un agente anabólico eficaz (es decir, el crecimiento del hueso) utilizado en el tratamiento de algunas formas de osteoporosis y también ocasionalmente utilizado fuera de la etiqueta para acelerar la curación de la fractura. Teriparatide Acetate 52232-67-4 es conocido por acción rápida, calidad constante y alta pureza. Somos apreciados por porciones de clientes que cooperamos.



Thera. Goría gato: péptido Farmacéutica

Cas. No: 52232-67-4

Sinónimos: Hormona paratiroidea HUMANOS: Fragmento 1-34; Hormona paratiroidea (humanos, 1-34); La hormona paratiroidea (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); La teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Fórmula molecular: C172H278N52O47S2

Peso molecular: 3890.49792

Pureza: ≥98%

Embalaje: embalaje de exportación digna

Hoja de Seguridad: Disponible a pedido

Uso: en el tratamiento de algunas formas de osteoporosis

PRODUCTOS POR GRUPO : Productos Peptídicos

Imagen de Producto
  • Fragmento de la hormona paratiroidea (1-34) (CAS 52232-67-4)
Contactar proveedor
  • *Asunto:
  • *Mensajes:
    Su mensaje debe ser de entre 20 a 8,000 caracteres.

Sitio Web Mobile índice. Mapa del sitio


Suscríbete a nuestro boletín:
¡Obtén actualizaciones, ofertas especiales, grandes premios y descuentos!

MultiLanguage:
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd. Todos los derechos reservados.
Contactar Proveedor?Proveed
Amy Cheng Ms. Amy Cheng
¿Qué puedo hacer por ti?
Chatear Ahora Contactar Proveedor